PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA16933
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family MYB
Protein Properties Length: 554aa    MW: 62449.1 Da    PI: 5.0031
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA16933genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.83.7e-163986148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT  Ed++lv++vk+ G g+W+++ ++ g+ R++k+c++rw ++l
  Tp57577_TGAC_v2_mRNA16933 39 KGPWTSAEDDILVNYVKKNGEGNWNAVHKHTGLLRCGKSCRLRWANHL 86
                               79******************************99**********9986 PP

2Myb_DNA-binding44.14.6e-1492135146
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                +g +T+ E++l+ ++++++G++ W++ a+ ++ gRt++++k++w++
  Tp57577_TGAC_v2_mRNA16933  92 KGTFTAAEEQLICELHAKMGNK-WARMASFLP-GRTDNEIKNYWNT 135
                                799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.0913486IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.1E-223789IPR009057Homeodomain-like
SMARTSM007172.2E-133888IPR001005SANT/Myb domain
SuperFamilySSF466891.02E-2838133IPR009057Homeodomain-like
PfamPF002491.9E-143986IPR001005SANT/Myb domain
CDDcd001672.21E-104186No hitNo description
PROSITE profilePS5129423.33987141IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.2E-2490140IPR009057Homeodomain-like
SMARTSM007178.7E-1591139IPR001005SANT/Myb domain
PfamPF002495.1E-1392135IPR001005SANT/Myb domain
CDDcd001673.33E-1094135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
MMRRMKKEIE DEMFHDGETE LQLYDEGYDG SACGVVLKKG PWTSAEDDIL VNYVKKNGEG  60
NWNAVHKHTG LLRCGKSCRL RWANHLRPNL KKGTFTAAEE QLICELHAKM GNKWARMASF  120
LPGRTDNEIK NYWNTRIKRR HRAGLPLYPP EVWQQVLHGQ NTGGINRING RNKVHPDFLP  180
KKYFDKHDAI FDSLKDNHGI LPYVPELPDI SAYGNMLNGF DSSSQYCSFV PSTSSNHKRF  240
QESTMPFLDF SYIDRNGFYP FDHVQDDTFD KLTQSFGVQS PLDPGPSLHS SMCYSHSIMN  300
DNSSTSKPFE AAKLELPSLQ NSEIDLGSWV TSPPPPLLES IDDFIQSPAP ISTLESDCSS  360
PQNSGLLQSV LYQRKTPSSS KHQYYDNSSN SSTATPGERE DSSALNMYET EWEDYADPVS  420
PFGASSILNE CPAVSANRDS LDEQPPVHNI NGNIVKLEYV DQVWTPDDSE NQITSLLNFS  480
RPDFLLASDW YEHYSGHDKN QTITDATSMF FEDQLATNYK HTPAGTSNPS QVWEFGSLAW  540
NNMPAVYQIS DLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-30371405107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013445158.10.0myb transcription factor
TrEMBLA0A072TNU80.0A0A072TNU8_MEDTR; Myb transcription factor
STRINGGLYMA13G25716.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.11e-115myb domain protein 65